SERPAnalytics:    Sign Up    Sign In   
Feedback     Pricing    
Keyword: "isokern fireplaces"
jump to: related keywords   competitors
Top site for "isokern fireplaces": whois.domaintools.com

Title: Whois lookup and Domain name search
Description:
Whois lookups for hundreds of TLDs with site details like IP location, screenshots, whois history, name server, IP History, blacklist status, SEO score, Alexa rank and more!

Approx. monthly SE traffic: 14.62M
Approx. monthly SE traffic cost equivalent: $11.55M

Avg.CPC: N/A
Searches: N/A
Broad Searches: N/A
Niche value (searches * cpc): N/A

"isokern fireplaces" related keywords

Keyword Searches Avg. CPC Searches*CPC Results
isokern fireplaces 390 $0.6 $234 4.44K
isokern fireplace 880 $0.65 $572 6.03K

"isokern fireplaces" related sites

IP: 204.0.5.25
Rank: $11.55M
Traffic: 14.62M

 Whois.domaintools.com: Whois lookup and Domain name search

Whois lookups for hundreds of TLDs with site details like IP location, screenshots, whois history, name server, IP History, blacklist status, SEO score, Alexa rank and more!

Keywords: 

gmail com; hotmail.com; hotmail com; btinternet.com; orkut.com; orkut.com; www facebook com; orkut login; whois domain; youtobe;
Positions count: 101.36K
Rank: $111.43
Traffic: 215.6

 Maineisokernfireplaceandchimneydealer.com: Somerset Stone Center & Excavation - Maine Isokern Fireplace and Chimney Systems

Maine Isokern Fireplace and Chimney Dealer - Modular masonry fireplace and chimney systems manufactured from volcanic pumice. Interior and Exterior fireplace systems.

Keywords: 

isokern; isokern fireplace; isokern fireplaces; isokern prices; isokern fireplace cost; isokern chimney; isokern fireplace dealers; isokern outdoor fireplace; somerset systems; isokern fire place;
Positions count: 10
IP: 208.109.181.191
Rank: $108.42
Traffic: 196.07

 Afcfireplaces.com: AFC Fireplace and Chimney - Distributors of Isokern Fireplace and Chimney Systems

Keywords: 

isokern; isokern fireplace; isokern fireplaces; isokern chimney; isokern fireplace dealers; isokern fire place;
Positions count: 6
IP: 66.226.64.28
Rank: $162.43
Traffic: 319.81

 Rusticfireplaceinc.com: Isokern Fireplace and Chimney Systems -- Sacramento -- Rustic Fire Place

Keywords: 

isokern; isokern fireplace; isokern fireplaces; chimney systems; fireplace systems; isokern fireplace cost; isokern chimney; isokern prices; rustic brick sacramento; rustic fireplace accessories;
Positions count: 13
IP: 209.66.83.99
Rank: $153.79K
Traffic: 217.31K

 Shopzilla.com: Shopzilla - Comparison shopping online

Shop smart and shop fast at Shopzilla! Read reviews, compare prices, and get the right product at the right price every time.

Keywords: 

shopping; shopzilla; shopzilla; miscellaneous books; shopzilla.com; photography darkroom equipment; electric irons; computer gaming software; platform women's shoes; maternity intimate apparel;
Adtexts count: 623.50K; AdTraffic: 9.60M; Adwords budget: $9.02M; Positions count: 32.35K
Rank: $578.23
Traffic: 993.37

 Earthcoreindustries.com: Earthcore Industries, Inc.

North American supplier of Isokern fireplaces and chimney systems and other contemporary hearth related products.

Keywords: 

isokern; earth core; clay chimney pots; clay chimney; clay chimney pot; isokern fireplace; colonial brick; isokern fireplaces; colonial brick; chimney clay;
Positions count: 22
IP: 66.135.46.200
Rank: $1.20K
Traffic: 1.34K

 Fireplacedistributors.net: California Fireplaces, Fireplace Distributors for Southern California - Lennox, FMI, Isokern, Heat-n--Glo, Heatilator, Kiva fireplaces

Southern California's source for fireplaces, custom glass doors, gas logs and chimney systems. Fireplaces froom Lennox, FMI, Isokern, Heat-n-glo, Heatilator and Adobelite Kiva.

Keywords: 

lennox fireplaces; heat n glo; heat-n-glo; isokern; fireplace distributors; fmi fireplaces; heat-n-glo; kiva fireplace; fireplace replacement; beehive fireplace;
Positions count: 110
 1   2   next
Other top keywords: cduniverse pat green keylogger jump massachusetts insurance auto
Random keywords: oem company naruto boxed set millay sonnets ukraine train tickets disney media network
See also our FREE Top 10000 Keywords Tool

 
About  Affiliate program  Pricing  Top Keywords+    Top Sites+    Privacy Policy  Terms of Use