Average cost per click |
Avg.CPC: N/A |
Number of monthly searches for this keyword |
Searches: N/A |
Number of monthly searches for queries containing this keyword |
Broad Searches: N/A |
(Average cost per click) * (Number of monthly searches for this keyword) |
Niche value (searches * cpc): N/A |
|
IP: 204.0.5.25 Rank: $11.55M Traffic: 14.62M |
Whois.domaintools.com: Whois lookup and Domain name searchWhois lookups for hundreds of TLDs with site details like IP location, screenshots, whois history, name server, IP History, blacklist status, SEO score, Alexa rank and more!
Keywords:gmail com; hotmail.com; hotmail com; btinternet.com; orkut.com; orkut.com; www facebook com; orkut login; whois domain; youtobe;Positions count: 101.36K |
Rank: $111.43 Traffic: 215.6 |
Maineisokernfireplaceandchimneydealer.com: Somerset Stone Center & Excavation - Maine Isokern Fireplace and Chimney SystemsMaine Isokern Fireplace and Chimney Dealer - Modular masonry fireplace and chimney systems manufactured from volcanic pumice. Interior and Exterior fireplace systems.
Keywords:isokern; isokern fireplace; isokern fireplaces; isokern prices; isokern fireplace cost; isokern chimney; isokern fireplace dealers; isokern outdoor fireplace; somerset systems; isokern fire place;Positions count: 10 |
IP: 208.109.181.191 Rank: $108.42 Traffic: 196.07 |
Afcfireplaces.com: AFC Fireplace and Chimney - Distributors of Isokern Fireplace and Chimney SystemsKeywords:isokern; isokern fireplace; isokern fireplaces; isokern chimney; isokern fireplace dealers; isokern fire place;Positions count: 6 |
IP: 66.226.64.28 Rank: $162.43 Traffic: 319.81 |
Rusticfireplaceinc.com: Isokern Fireplace and Chimney Systems -- Sacramento -- Rustic Fire PlaceKeywords:isokern; isokern fireplace; isokern fireplaces; chimney systems; fireplace systems; isokern fireplace cost; isokern chimney; isokern prices; rustic brick sacramento; rustic fireplace accessories;Positions count: 13 |
IP: 209.66.83.99 Rank: $153.79K Traffic: 217.31K |
Shopzilla.com: Shopzilla - Comparison shopping onlineShop smart and shop fast at Shopzilla! Read reviews, compare prices, and get the right product at the right price every time.
Keywords:shopping; shopzilla; shopzilla; miscellaneous books; shopzilla.com; photography darkroom equipment; electric irons; computer gaming software; platform women's shoes; maternity intimate apparel;Adtexts count: 623.50K; AdTraffic: 9.60M; Adwords budget: $9.02M; Positions count: 32.35K |
Rank: $578.23 Traffic: 993.37 |
Earthcoreindustries.com: Earthcore Industries, Inc.North American supplier of Isokern fireplaces and chimney systems and other contemporary hearth related products.
Keywords:isokern; earth core; clay chimney pots; clay chimney; clay chimney pot; isokern fireplace; colonial brick; isokern fireplaces; colonial brick; chimney clay;Positions count: 22 |
IP: 66.135.46.200 Rank: $1.20K Traffic: 1.34K |
Fireplacedistributors.net: California Fireplaces, Fireplace Distributors for Southern California - Lennox, FMI, Isokern, Heat-n--Glo, Heatilator, Kiva fireplacesSouthern California's source for fireplaces, custom glass doors, gas logs and chimney systems. Fireplaces froom Lennox, FMI, Isokern, Heat-n-glo, Heatilator and Adobelite Kiva.
Keywords:lennox fireplaces; heat n glo; heat-n-glo; isokern; fireplace distributors; fmi fireplaces; heat-n-glo; kiva fireplace; fireplace replacement; beehive fireplace;Positions count: 110 |